PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS73619.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 25452 Da    PI: 5.9675
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS73619.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.85.2e-271059251
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                +i+n + rqvtfskRr g++KKAeEL vLCda+va+i+fss+gkl+ey+s
  EPS73619.1 10 KIDNVTARQVTFSKRRRGLFKKAEELAVLCDADVALIVFSSSGKLFEYAS 59
                69**********************************************86 PP

2K-box51.64e-18931712098
       K-box  20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 +++ L ke+ +  +++R++ Ge+L++Ls++eLqqLe+ +e++l+++ +kK e ++e+i++lq+k k+l een +L+k++
  EPS73619.1  93 NYSMLSKEVAERTNQLRRMRGEELNELSIQELQQLEKSIESGLSRVMEKKGERIMEEIKRLQEKGKQLMEENVRLKKRV 171
                 5777888888888999***********************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.011161IPR002100Transcription factor, MADS-box
SMARTSM004324.0E-38160IPR002100Transcription factor, MADS-box
CDDcd002652.80E-38269No hitNo description
PRINTSPR004048.1E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-30370IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.95187178IPR002487Transcription factor, K-box
PfamPF014863.3E-1692171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAREKIQIRK IDNVTARQVT FSKRRRGLFK KAEELAVLCD ADVALIVFSS SGKLFEYASS  60
SMKEILERHD LHAKNLDKMD QPSLELQLVE DSNYSMLSKE VAERTNQLRR MRGEELNELS  120
IQELQQLEKS IESGLSRVME KKGERIMEEI KRLQEKGKQL MEENVRLKKR VVDMGRRSMM  180
MNDATMADSL NLAYDEGQSS ESVNASSGPP QDCESSDTSL KLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A4e-20272171Myocyte-specific enhancer factor 2A
3mu6_B4e-20272171Myocyte-specific enhancer factor 2A
3mu6_C4e-20272171Myocyte-specific enhancer factor 2A
3mu6_D4e-20272171Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097479.11e-121PREDICTED: MADS-box protein JOINTLESS
SwissprotQ9FUY62e-98JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLS8D1G31e-161S8D1G3_9LAMI; Uncharacterized protein
STRINGVIT_00s0313g00070.t011e-106(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-99MIKC_MADS family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]